2.93 Rating by CuteStat

It is a domain having review extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, warnersariintakesystems.review is SAFE to browse.

PageSpeed Score
76
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.64.119.203

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
warnersariintakesystems.review - Registered at Namecheap.com

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.64.119.203)

Domain Enquiry – Namebase

- smsify.com
Not Applicable $ 8.95

Mike Delaney's Prothink.org

- trutube.tv
Not Applicable $ 8.95

elFilm.com

- elfilm.com
6,409,174 $ 240.00

Gnutella Forums

- gnutelliums.com

gnutella_forums_help_assist_problems_using_and_where_download_software,limewire,wireshare,frostier,frostier,phex,bearshare,shareaza,morpheus,gnucleus,gtk-gnutella,gnucdna,qtella,napshare,xolox,blackflag,getchaman,gnutelliums, World's_Best_File_Sharing_Softwares, pirate_edition,lpe,Linux_Unix_Mac_OSX_Windows_BSD_Darwin_

Not Applicable $ 8.95

panduantogelonline.com - Registered at Namecheap.com

- panduantogelonline.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Mon, 11 Dec 2017 22:55:48 GMT
Content-Type: text/html; charset=utf-8
Cache-Control: no-cache
Pragma: no-cache
Expires: -1
X-CST: MISS
X-Cache: MISS from proxy-node-026
X-Cache-Lookup: MISS from proxy-node-026:4896
Transfer-Encoding: chunked
Via: 1.1 proxy-node-026 (squid/3.5.12)
Connection: keep-alive

Domain Nameserver Information

Host IP Address Country
dns1.registrar-servers.com 156.154.132.200 United States of America United States of America
dns2.registrar-servers.com 156.154.133.200 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
warnersariintakesystems.review A 1800 IP: 192.64.119.203
warnersariintakesystems.review NS 1800 Target: dns1.registrar-servers.com
warnersariintakesystems.review NS 1800 Target: dns2.registrar-servers.com
warnersariintakesystems.review SOA 3601 MNAME: dns1.registrar-servers.com
RNAME: hostmaster.registrar-servers.com
Serial: 2017121001
Refresh: 43200
Retry: 3600
Expire: 604800
Minimum TTL: 3601
warnersariintakesystems.review MX 1800 Priority: 15
Target: eforward4.registrar-servers.com
warnersariintakesystems.review MX 1800 Priority: 10
Target: eforward1.registrar-servers.com
warnersariintakesystems.review MX 1800 Priority: 10
Target: eforward2.registrar-servers.com
warnersariintakesystems.review MX 1800 Priority: 20
Target: eforward5.registrar-servers.com
warnersariintakesystems.review MX 1800 Priority: 10
Target: eforward3.registrar-servers.com
warnersariintakesystems.review TXT 1800 TXT: v=spf1
include:spf.efwd.registrar-servers.com
~all

Full WHOIS Lookup

Number of allowed queries exceeded.