Web Analysis for Warnersariintakesystems - warnersariintakesystems.review
2.93
Rating by CuteStat
It is a domain having review extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, warnersariintakesystems.review is SAFE to browse.
PageSpeed Score
76
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 2 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 2 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 192.64.119.203)
Gnutella Forums
- gnutelliums.com
gnutella_forums_help_assist_problems_using_and_where_download_software,limewire,wireshare,frostier,frostier,phex,bearshare,shareaza,morpheus,gnucleus,gtk-gnutella,gnucdna,qtella,napshare,xolox,blackflag,getchaman,gnutelliums, World's_Best_File_Sharing_Softwares, pirate_edition,lpe,Linux_Unix_Mac_OSX_Windows_BSD_Darwin_
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Server: nginx
Date: Mon, 11 Dec 2017 22:55:48 GMT
Content-Type: text/html; charset=utf-8
Cache-Control: no-cache
Pragma: no-cache
Expires: -1
X-CST: MISS
X-Cache: MISS from proxy-node-026
X-Cache-Lookup: MISS from proxy-node-026:4896
Transfer-Encoding: chunked
Via: 1.1 proxy-node-026 (squid/3.5.12)
Connection: keep-alive
Server: nginx
Date: Mon, 11 Dec 2017 22:55:48 GMT
Content-Type: text/html; charset=utf-8
Cache-Control: no-cache
Pragma: no-cache
Expires: -1
X-CST: MISS
X-Cache: MISS from proxy-node-026
X-Cache-Lookup: MISS from proxy-node-026:4896
Transfer-Encoding: chunked
Via: 1.1 proxy-node-026 (squid/3.5.12)
Connection: keep-alive
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
dns1.registrar-servers.com | 156.154.132.200 | United States of America | |
dns2.registrar-servers.com | 156.154.133.200 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
warnersariintakesystems.review | A | 1800 |
IP: 192.64.119.203 |
warnersariintakesystems.review | NS | 1800 |
Target: dns1.registrar-servers.com |
warnersariintakesystems.review | NS | 1800 |
Target: dns2.registrar-servers.com |
warnersariintakesystems.review | SOA | 3601 |
MNAME: dns1.registrar-servers.com RNAME: hostmaster.registrar-servers.com Serial: 2017121001 Refresh: 43200 Retry: 3600 Expire: 604800 Minimum TTL: 3601 |
warnersariintakesystems.review | MX | 1800 |
Priority: 15 Target: eforward4.registrar-servers.com |
warnersariintakesystems.review | MX | 1800 |
Priority: 10 Target: eforward1.registrar-servers.com |
warnersariintakesystems.review | MX | 1800 |
Priority: 10 Target: eforward2.registrar-servers.com |
warnersariintakesystems.review | MX | 1800 |
Priority: 20 Target: eforward5.registrar-servers.com |
warnersariintakesystems.review | MX | 1800 |
Priority: 10 Target: eforward3.registrar-servers.com |
warnersariintakesystems.review | TXT | 1800 |
TXT: v=spf1 include:spf.efwd.registrar-servers.com ~all |
Full WHOIS Lookup
Number of allowed queries exceeded.